Mouse Anti-Dog CYP2A13 Antibody (MO-AB-30003W)


Cat: MO-AB-30003W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO30003W
SpecificityThis antibody binds to Dog CYP2A13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP2A13 (Cytochrome P450 Family 2 Subfamily A Member 13) is a Protein Coding gene. Diseases associated with CYP2A13 include Acetaminophen Metabolism. Among its related pathways are Acetaminophen Pathway (therapeutic doses), Pharmacokinetics and Metabolism. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP2A6.
Product OverviewMouse Anti-Dog CYP2A13 Antibody is a mouse antibody against CYP2A13. It can be used for CYP2A13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome P450 2A13; CYP2A13
UniProt IDQ307K8
Protein RefseqThe length of the protein is 494 amino acids long.
The sequence is show below: MLASGLLLVALLACLTIIVLMSVWKQRKLGGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRPVVVLCGHEAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGFLIEALRGTRGAFIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSMGQLYEMFYSVMKHLPGPQQQAFKELQGLEDFITKKVEQNQRTLDPNSPRDFIDSFLIRMQEEQNNPNTEFYLKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKHPDVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMIPMGVARRVIKDTKFREFLLPKGTEVFPMLGSVLRDAKFFSNPQDFHPQHFLDEKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTTILQNFHFKSPQLPQDIDVSPKHVGFATIPRNYTMSFQPR.
For Research Use Only | Not For Clinical Use.
Online Inquiry