Mouse Anti-Dog HMGA1 Antibody (MO-AB-31125W)


Cat: MO-AB-31125W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO31125W
SpecificityThis antibody binds to Dog HMGA1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes.
Product OverviewMouse Anti-Dog HMGA1 Antibody is a mouse antibody against HMGA1. It can be used for HMGA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHigh mobility group protein HMG-I / HMG-Y; HMG-I(Y); High mobility group AT-hook protein 1; High mobility group protein A1; HMGA1; HMGIY
UniProt IDQ6URC2
Protein RefseqThe length of the protein is 107 amino acids long.
The sequence is show below: MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry