Mouse Anti-Dog HTRA2 Antibody (MO-AB-31203W)


Cat: MO-AB-31203W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO31203W
SpecificityThis antibody binds to Dog HTRA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Cytosol; Cytoskeleton; Mitochondrion; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Dog HTRA2 Antibody is a mouse antibody against HTRA2. It can be used for HTRA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtease serine 25; HTRA2
UniProt IDQ45FF7
Protein RefseqThe length of the protein is 458 amino acids long.
The sequence is show below: MAALRAGRGAAWNLRGWRALGGVHSGKGPLLTPDLRALLTSGIPDPRARVTYGTPSLRARWSVGVPEPRTCLTSRTSDSRAWLAVGTPDPRTQEGSGTPGTRPRIWLAVALGAGGAVLLLLWGGGRGPPAVLASVLGSPPSSPRSQYNFIADVVEKTAPAVVYIEILGRHPFSGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGISGSQRRYIGVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVILDSPAHRAGLRPGDVILAIGEQLVQNAEDIYEAVRTQSQLAVRIRRGPETLTLYVTPEVTE.
For Research Use Only | Not For Clinical Use.
Online Inquiry