Mouse Anti-Dog IL1B Antibody (MO-AB-31270W)


Cat: MO-AB-31270W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO31270W
SpecificityThis antibody binds to Dog IL1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Lysosome; Cytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
Product OverviewMouse Anti-Dog IL1B Antibody is a mouse antibody against IL1B. It can be used for IL1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterleukin-1 beta; IL-1 beta; IL1B
UniProt IDQ28292
Protein RefseqThe length of the protein is 266 amino acids long.
The sequence is show below: MAAVPELTSEMMAYSSNNENDLFFEADGPGNDVKCCCQDLNHSSLVDEGIQLQVSHQLCNKSLRHFVSVIVALEKLKKPCPQVLQEDDLKSIFCYIFEEEPIICKTDADNFMSDAAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry