Mouse Anti-Dog OAT Antibody (MO-AB-32248W)
Cat: MO-AB-32248W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Dog (Canis lupus familiaris) |
Clone | MO32248W |
Specificity | This antibody binds to Dog OAT. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes the mitochondrial enzyme ornithine aminotransferase, which is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations that result in a deficiency of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy. Alternatively spliced transcript variants encoding different isoforms have been described. Related pseudogenes have been defined on the X chromosome. |
Product Overview | Mouse Anti-Dog OAT Antibody is a mouse antibody against OAT. It can be used for OAT detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ornithine aminotransferase; OAT |
UniProt ID | O46389 |
Protein Refseq | The length of the protein is 31 amino acids long. The sequence is show below: FMVEPIQGEAGVVVPDPGYLMGVRELCTQHQ. |
See other products for " OAT "
MO-AB-70110W | Mouse Anti-Silkworm OAT Antibody (MO-AB-70110W) |
MO-AB-00444W | Mouse Anti-Barrel medic oat Antibody (MO-AB-00444W) |
MO-AB-17289W | Mouse Anti-Chimpanzee OAT Antibody (MO-AB-17289W) |
MO-AB-60539W | Mouse Anti-Marmoset OAT Antibody (MO-AB-60539W) |
CBMOAB-35035FYB | Mouse Anti-Rice OAT Antibody (CBMOAB-35035FYB) |
CBMOAB-90427FYA | Mouse Anti-Zebrafish oat Antibody (CBMOAB-90427FYA) |
MO-AB-17083R | Mouse Anti-Cattle OAT Antibody (MO-AB-17083R) |
MO-AB-34978H | Mouse Anti-Tomato OAT Antibody (MO-AB-34978H) |
MO-AB-05859H | Mouse Anti-Frog oat Antibody (MO-AB-05859H) |
CBMOAB-26143FYA | Mouse Anti-D. melanogaster Oat Antibody (CBMOAB-26143FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry