Mouse Anti-Dog Thy1 Antibody (MO-AB-33721W)
Cat: MO-AB-33721W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Dog (Canis lupus familiaris) |
Clone | MO33721W |
Specificity | This antibody binds to Dog Thy1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. The encoded protein is widely used as a marker for hematopoietic stem cells. This gene may function as a tumor suppressor in nasopharyngeal carcinoma. Alternative splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Dog Thy1 Antibody is a mouse antibody against Thy1. It can be used for Thy1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Thy-1; Thy1 |
UniProt ID | Q9XT67 |
Protein Refseq | The length of the protein is 60 amino acids long. The sequence is show below: GTVGVPEHSYRSRTNFTSKYNIKVLYLSGFTTKDEGTYTCELRLSGQPPITSSKNVTVLR. |
See other products for " THY1 "
MO-AB-66178W | Mouse Anti-Marmoset THY1 Antibody (MO-AB-66178W) |
CBMOAB-00131FYA | Mouse Anti-Dog THY1 Antibody (CBMOAB-00131FYA) |
MO-AB-04420Y | Mouse Anti-Chicken THY1 Antibody (MO-AB-04420Y) |
CBMOAB-09397FYB | Mouse Anti-Zebrafish thy1 Antibody (CBMOAB-09397FYB) |
MO-AB-46801W | Mouse Anti-Horse THY1 Antibody (MO-AB-46801W) |
MO-AB-20910W | Mouse Anti-Chimpanzee THY1 Antibody (MO-AB-20910W) |
MO-AB-21564R | Mouse Anti-Cattle THY1 Antibody (MO-AB-21564R) |
MO-AB-29451H | Mouse Anti-Rat Thy1 Antibody (MO-AB-29451H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry