Mouse Anti-Dog WNT1 Antibody (MO-AB-34055W)
Cat: MO-AB-34055W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Dog (Canis lupus familiaris) |
Clone | MO34055W |
Specificity | This antibody binds to Dog WNT1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is very conserved in evolution, and the protein encoded by this gene is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. This gene is clustered with another family member, WNT10B, in the chromosome 12q13 region. |
Product Overview | Mouse Anti-Dog WNT1 Antibody is a mouse antibody against WNT1. It can be used for WNT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein Wnt; WNT1 |
UniProt ID | E2RTG8 |
Protein Refseq | The length of the protein is 370 amino acids long. The sequence is show below: MGHWALLPGGVSAALLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTASGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL. |
See other products for " WNT1 "
CBMOAB-62409FYA | Mouse Anti-Rhesus WNT1 Antibody (CBMOAB-62409FYA) |
MO-AB-35979W | Mouse Anti-Ferret WNT1 Antibody (MO-AB-35979W) |
MO-AB-01673L | Mouse Anti-Elephant WNT1 Antibody (MO-AB-01673L) |
CBMOAB-16294FYB | Mouse Anti-Zebrafish wnt1 Antibody (CBMOAB-16294FYB) |
MO-AB-10489Y | Mouse Anti-Rabbit WNT1 Antibody (MO-AB-10489Y) |
MO-AB-08468W | Mouse Anti-Cat WNT1 Antibody (MO-AB-08468W) |
MO-AB-31247R | Mouse Anti-Pig WNT1 Antibody (MO-AB-31247R) |
MO-AB-47074W | Mouse Anti-Horse WNT1 Antibody (MO-AB-47074W) |
MO-AB-17976W | Mouse Anti-Chimpanzee WNT1 Antibody (MO-AB-17976W) |
MO-AB-42849W | Mouse Anti-Guinea pig WNT1 Antibody (MO-AB-42849W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry