Mouse Anti-Donkey IL17A Antibody (MO-AB-34250W)
Cat: MO-AB-34250W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Donkey (Equus asinus) |
Clone | MO34250W |
Specificity | This antibody binds to Donkey IL17A. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. |
Product Overview | Mouse Anti-Donkey IL17A Antibody is a mouse antibody against IL17A. It can be used for IL17A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Interleukin-17A; IL17A |
UniProt ID | U5N4A2 |
Protein Refseq | The length of the protein is 43 amino acids long. The sequence is show below: MAPLRTSSVSLLLLLSLVAIVKAGIVIPQNPECPNTGDKNFPQ. |
See other products for " IL17A "
MO-AB-11813Y | Mouse Anti-O. mykiss IL17A Antibody (MO-AB-11813Y) |
MO-AB-31262W | Mouse Anti-Dog IL17A Antibody (MO-AB-31262W) |
MO-AB-26646R | Mouse Anti-Pig IL17A Antibody (MO-AB-26646R) |
MOFY-0622-FY213 | Rabbit Anti-IL17A Antibody (MOFY-0622-FY213) |
MO-AB-02467Y | Mouse Anti-Chicken IL17A Antibody (MO-AB-02467Y) |
CBMOAB-00094FYA | Mouse Anti-Cattle IL17A Antibody (CBMOAB-00094FYA) |
MOFY-0722-FY166 | Rabbit Anti-IL17A Antibody (MOFY-0722-FY166) |
MOFY-0622-FY103 | Rabbit Anti-IL17A Antibody (MOFY-0622-FY103) |
MO-AB-57198W | Mouse Anti-Marmoset IL17A Antibody (MO-AB-57198W) |
MO-AB-37490W | Mouse Anti-Goat IL17A Antibody (MO-AB-37490W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry