AibGenesis™ Mouse Anti-DPCD Antibody (CBMOAB-41128FYA)


Cat: CBMOAB-41128FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41128FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO41128FYA 100 µg
CBMOAB-74018FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74018FYA 100 µg
MO-AB-11615R Monoclonal Cattle (Bos taurus) WB, ELISA MO11615R 100 µg
MO-AB-14388W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14388W 100 µg
MO-AB-25471H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25471C 100 µg
MO-AB-54455W Monoclonal Marmoset WB, ELISA MO54455W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO41128FYA
SpecificityThis antibody binds to Rhesus DPCD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene in mouse encodes a protein that may be involved in the generation and maintenance of ciliated cells. In mouse, expression of this gene increases during ciliated cell differentiation, and disruption of this gene has been linked to primary ciliary dyskinesia. (From NCBI)
Product OverviewMouse Anti-Rhesus DPCD Antibody is a mouse antibody against DPCD. It can be used for DPCD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein DPCD; DPCD
UniProt IDH9F3L1
Protein RefseqThe length of the protein is 175 amino acids long.
The sequence is show below: LFPDGKEMAEQYYEKTSELLVRKWRVKSALGAMGQWQLEVGEPAPLGAGNLGPELIKESNANPIFMRKDTKKSFQWRIRNLPYPKDVYGVCVDQKERCIIVKTTNKKYYKKFSIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHGNDGDCKTQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry