Mouse Anti-DPH1 Antibody (CBMOAB-01065CR)


Cat: CBMOAB-01065CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-01065CR Monoclonal Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Medaka (Oryzias latipes), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO01065CR 100 µg
CBMOAB-02886HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO02886HB 100 µg
CBMOAB-41135FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO41135FYA 100 µg
CBMOAB-74033FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74033FYA 100 µg
MO-AB-00389L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00389L 100 µg
MO-AB-00413R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00413R 100 µg
MO-AB-01642Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01642Y 100 µg
MO-AB-02506W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02506W 100 µg
MO-AB-07926Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07926Y 100 µg
MO-AB-11622R Monoclonal Cattle (Bos taurus) WB, ELISA MO11622R 100 µg
MO-AB-14986Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14986Y 100 µg
MO-AB-22912W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22912W 100 µg
MO-AB-30571W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30571W 100 µg
MO-AB-44457W Monoclonal Horse (Equus caballus) WB, ELISA MO44457W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Medaka (Oryzias latipes), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO01065CR
SpecificityThis antibody binds to Yeast DPH1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an enzyme involved in the biosynthesis of diphthamide, a modified histidine found only in elongation factor-2 (EEF2). Diphthamide residues in EEF2 are targeted for ADP-ribosylation by diphtheria toxin and Pseudomonas exotoxin A. Defects in this gene have been associated with both ovarian cancer and autosomal recessive intellectual disability with short stature, craniofacial, and ectodermal anomalies.
Product OverviewMouse Anti-Yeast DPH1 Antibody is a mouse antibody against DPH1. It can be used for DPH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDiphthamide biosynthesis protein 1; DPH1; YIL103W
UniProt IDP40487
Protein RefseqThe length of the protein is 425 amino acids long. The sequence is show below: MSGSTESKKQPRRRFIGRKSGNSNNDKLTTVAENGNEIIHKQKSRIALGRSVNHVPEDILNDKELNEAIKLLPSNYNFEIHKTVWNIRKYNAKRIALQMPEGLLIYSLIISDILEQFCGVETLVMGDVSYGACCIDDFTARALDCDFIVHYAHSCLVPIDVTKIKVLYVFVTINIQEDHIIKTLQKNFPKGSRIATFGTIQFNPAVHSVRDKLLNDEEHMLYIIPPQIKPLSRGEVLGCTSERLDKEQYDAMVFIGDGRFHLESAMIHNPEIPAFKYDPYNRKFTREGYDQKQLVEVRAEAIEVARKGKVFGLILGALGRQGNLNTVKNLEKNLIAAGKTVVKIILSEVFPQKLAMFDQIDVFVQVACPRLSIDWGYAFNKPLLTPYEASVLLKKDVMFSEKYYPMDYYEAKGYGRGETPKHAIE.
For Research Use Only | Not For Clinical Use.
Online Inquiry