Mouse Anti-DPH1 Antibody (CBMOAB-01065CR)
Cat: CBMOAB-01065CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-01065CR | Monoclonal | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Medaka (Oryzias latipes), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO01065CR | 100 µg | ||
CBMOAB-02886HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO02886HB | 100 µg | ||
CBMOAB-41135FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO41135FYA | 100 µg | ||
CBMOAB-74033FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO74033FYA | 100 µg | ||
MO-AB-00389L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00389L | 100 µg | ||
MO-AB-00413R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00413R | 100 µg | ||
MO-AB-01642Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01642Y | 100 µg | ||
MO-AB-02506W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02506W | 100 µg | ||
MO-AB-07926Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07926Y | 100 µg | ||
MO-AB-11622R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11622R | 100 µg | ||
MO-AB-14986Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14986Y | 100 µg | ||
MO-AB-22912W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22912W | 100 µg | ||
MO-AB-30571W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30571W | 100 µg | ||
MO-AB-44457W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44457W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Medaka (Oryzias latipes), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO01065CR |
Specificity | This antibody binds to Yeast DPH1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is an enzyme involved in the biosynthesis of diphthamide, a modified histidine found only in elongation factor-2 (EEF2). Diphthamide residues in EEF2 are targeted for ADP-ribosylation by diphtheria toxin and Pseudomonas exotoxin A. Defects in this gene have been associated with both ovarian cancer and autosomal recessive intellectual disability with short stature, craniofacial, and ectodermal anomalies. |
Product Overview | Mouse Anti-Yeast DPH1 Antibody is a mouse antibody against DPH1. It can be used for DPH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Diphthamide biosynthesis protein 1; DPH1; YIL103W |
UniProt ID | P40487 |
Protein Refseq | The length of the protein is 425 amino acids long. The sequence is show below: MSGSTESKKQPRRRFIGRKSGNSNNDKLTTVAENGNEIIHKQKSRIALGRSVNHVPEDILNDKELNEAIKLLPSNYNFEIHKTVWNIRKYNAKRIALQMPEGLLIYSLIISDILEQFCGVETLVMGDVSYGACCIDDFTARALDCDFIVHYAHSCLVPIDVTKIKVLYVFVTINIQEDHIIKTLQKNFPKGSRIATFGTIQFNPAVHSVRDKLLNDEEHMLYIIPPQIKPLSRGEVLGCTSERLDKEQYDAMVFIGDGRFHLESAMIHNPEIPAFKYDPYNRKFTREGYDQKQLVEVRAEAIEVARKGKVFGLILGALGRQGNLNTVKNLEKNLIAAGKTVVKIILSEVFPQKLAMFDQIDVFVQVACPRLSIDWGYAFNKPLLTPYEASVLLKKDVMFSEKYYPMDYYEAKGYGRGETPKHAIE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry