Mouse Anti-DRG1 Antibody (MO-AB-24787W)


Cat: MO-AB-24787W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24787W Monoclonal Chimpanzee (Pan troglodytes), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO24787W 100 µg
CBMOAB-74124FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74124FYA 100 µg
MO-AB-07929Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07929Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO24787W
SpecificityThis antibody binds to Chimpanzee DRG1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDRG1 (Developmentally Regulated GTP Binding Protein 1) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include identical protein binding and transcription factor binding.
Product OverviewMouse Anti-Chimpanzee DRG1 Antibody is a mouse antibody against DRG1. It can be used for DRG1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDevelopmentally regulated GTP binding protein 1; DRG1
UniProt IDH2QLI6
Protein RefseqThe length of the protein is 367 amino acids long.
The sequence is show below: MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry