AibGenesis™ Mouse Anti-DUSP19 Antibody (CBMOAB-41313FYA)


Cat: CBMOAB-41313FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41313FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO41313FYA 100 µg
MO-AB-01956W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01956W 100 µg
MO-AB-03127H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03127C 100 µg
MO-AB-11740R Monoclonal Cattle (Bos taurus) WB, ELISA MO11740R 100 µg
MO-AB-25507H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25507C 100 µg
MO-AB-26764W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26764W 100 µg
MO-AB-54585W Monoclonal Marmoset WB, ELISA MO54585W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO41313FYA
SpecificityThis antibody binds to Rhesus DUSP19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DUSP19 Antibody is a mouse antibody against DUSP19. It can be used for DUSP19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDUSP19
UniProt IDF7FUP1
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: MHSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIKENSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry