AibGenesis™ Mouse Anti-dynlt3 Antibody (CBMOAB-74289FYA)


Cat: CBMOAB-74289FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-74289FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO74289FYA 100 µg
MO-AB-03145H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03145C 100 µg
MO-AB-11768R Monoclonal Cattle (Bos taurus) WB, ELISA MO11768R 100 µg
MO-AB-15124Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15124Y 100 µg
MO-AB-15949W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15949W 100 µg
MO-AB-25525H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25525C 100 µg
MO-AB-30632W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30632W 100 µg
MO-AB-54629W Monoclonal Marmoset WB, ELISA MO54629W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO74289FYA
SpecificityThis antibody binds to Zebrafish dynlt3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a subclass of dynein light chains. The encoded protein homodimerizes and forms the light chain component of the cytoplasmic dynein motor protein complex. This protein may be important for binding dynein to specific cargos including the spindle checkpoint protein BUB3. This protein may also function independently of dynein as a transcriptional modulator. Pseudogenes of this gene are found on chromosomes 2 and 20. (From NCBI)
Product OverviewMouse Anti-Zebrafish dynlt3 Antibody is a mouse antibody against dynlt3. It can be used for dynlt3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDynlt3 protein; T-complex-associated-testis-expressed 1-like; dynlt3; TCTE1L tcte1
UniProt IDQ6TGT3
Protein RefseqThe length of the protein is 115 amino acids long.
The sequence is show below: MEEYHSGDEVSFNPDDASNVVKECIEGIIGGVDYSQNKVNQWTASIVEHSLTQLVKQGKPFKYIVNCAVMQKSGAGLHTANSCYWDTTTDGSCTVRWENRTMYCVVSVFAVAIAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry