AibGenesis™ Mouse Anti-DZANK1 Antibody (CBMOAB-41373FYA)


Cat: CBMOAB-41373FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41373FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO41373FYA 100 µg
CBMOAB-74312FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74312FYA 100 µg
MO-AB-54638W Monoclonal Marmoset WB, ELISA MO54638W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO41373FYA
SpecificityThis antibody binds to Rhesus DZANK1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene contains two ankyrin repeat-encoding regions. Ankyrin repeats are tandemly repeated modules of about 33 amino acids described as L-shaped structures consisting of a beta-hairpin and two alpha-helices. Ankyrin repeats occur in a large number of functionally diverse proteins, mainly from eukaryotes, and are known to function as protein-protein interaction domains. Alternative splicing has been observed for this gene but the full-length nature of additional variants has not been determined. (From NCBI)
Product OverviewMouse Anti-Rhesus DZANK1 Antibody is a mouse antibody against DZANK1. It can be used for DZANK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDZANK1
UniProt IDF6XL16
Protein RefseqThe length of the protein is 614 amino acids long.
The sequence is show below: MLTSESFQRVHWKSQLTVEDQVLDHPPASPRQDIVPFTFKSFLFGHSMEIRPWKRKERTLFRGLLFQSPGFAHISALKCLTSTEIMRIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQPQASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQESICSGDKASPPPTQKGGTISCSRCGRWNLWEASFCGWCGAMLGIPAGCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAQEPRPFSESLNIPLPRSDAGTKRDIGTQTVGLFYPSGKLLAKKELEIASQKQRQEKMSDHKPLLTAISPGRGYWRRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVNFSDHLLSSAAEGDGGLCGSRSSWVSDYSQSTSDTIEKIKRIRNFKTKTFQEKEEQLLPENRLLLKEVGPTGEGRVSVIEQLLDEATDPNCCDEDNRPVITVAVMNKHHEAIPVLVQRGADIDQQWGPLRNTALHEATLLGFAGRESVATLLGCNASVRKKNAGGQTAYDLALNTGDDLITSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry