AibGenesis™ Mouse Anti-EEF1AKMT4 Antibody (MO-AB-11835R)


Cat: MO-AB-11835R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-11835R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO11835R 100 µg
MO-AB-25581H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25581C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO11835R
SpecificityThis antibody binds to Cattle EEF1AKMT4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the lysine-specific methyltransferase (KMT) family. The encoded enzyme catalyzes the methylation of lysine-36 of the eukaryotic translation elongation factor 1 alpha. Methylation by this enzyme may affect endoplasmic reticulum-related processes. (From NCBI)
Product OverviewMouse Anti-Cattle EEF1AKMT4 Antibody is a mouse antibody against EEF1AKMT4. It can be used for EEF1AKMT4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEndothelin-converting enzyme 2; ECE2
UniProt IDG3N1Q4
Protein RefseqThe length of the protein is 255 amino acids long.
The sequence is show below: MACLGPSAQVPELPEKNCGYREVQYWDQRYQGAADSAPYEWFGDFSCFRDLLEPELRPLDRILVLGCGNSALSYEIFLGGFPDVTSVDYSSVVVAAMRARYAHVPTLRWETMDVRALGFPSGSFDVVLEKGTLDALLTGEQDPWTVSSEGVHTVDQVLNEVSRVLVPAGRFISLTSAAPHFRTRHYAQAHYGWSLRHATYGNGFQFHFYLMQKGKELSVAQLAVGAQILSPPRPPTPSCFLQDSDHEDFLSAIQL.
For Research Use Only | Not For Clinical Use.
Online Inquiry