Mouse Anti-EFCAB3 Antibody (CBMOAB-41495FYA)


Cat: CBMOAB-41495FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41495FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO41495FYA 100 µg
MO-AB-03655W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03655W 100 µg
MO-AB-11852R Monoclonal Cattle (Bos taurus) WB, ELISA MO11852R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO41495FYA
SpecificityThis antibody binds to Rhesus EFCAB3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus EFCAB3 Antibody is a mouse antibody against EFCAB3. It can be used for EFCAB3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEFCAB3
UniProt IDF7F463
Protein RefseqThe length of the protein is 436 amino acids long.
The sequence is show below: MAVSEIKPKFKLNPLTKVPISHSKRDRDLPGSLQCQLQHKEKKLSASQMAAFQDAYNFFNKDKTGCIDFHGLMCTVAKLGMNLTKHDVYNELKCADIDRDGKVNFSDFIKVLTDKNLFLKAVVPEKETCLDLAGNPGILLFEILSKLLETSALPKKSILEIVSYFQRKFQHTGPGMLWSPYTMGYGKRTLKPDICTPPSSSMAAFANAARIAIMKEKDLFKFLEELKRCNSHSDSPYSKIPIFPLFPNVDGVVMGKPFKDMQKLEMLRRKEPLNFFEDYFFHKRDWKTQAANIKSMDPASGYSNNITIDQILKKKQTCTVADETAIKQHVKRATDTYNFGIALEHRKEMLNLWQKIRGDLIGIDSRNESFYDTFSTYTWSWNVCQELLSPKDLRLYDAYVNRNSSHNSRSFSSSDTSECDTDSGRKRKRKGLKGFQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry