Mouse Anti-EFNA2 Antibody (CBMOAB-41517FYA)


Cat: CBMOAB-41517FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41517FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO41517FYA 100 µg
CBMOAB-74546FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74546FYA 100 µg
MO-AB-11863R Monoclonal Cattle (Bos taurus) WB, ELISA MO11863R 100 µg
MO-AB-25592H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25592C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO41517FYA
SpecificityThis antibody binds to Rhesus EFNA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm.
Product OverviewMouse Anti-Rhesus EFNA2 Antibody is a mouse antibody against EFNA2. It can be used for EFNA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEFNA2
UniProt IDF7H827
Protein RefseqThe length of the protein is 167 amino acids long.
The sequence is show below: RFHAGEGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEPPEPIFTSNNSCSSLGGCRLFLSTIPLLWTLLGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry