Mouse Anti-EFNA3 Antibody (CBMOAB-41518FYA)


Cat: CBMOAB-41518FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41518FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset WB, ELISA MO41518FYA 100 µg
MO-AB-03207H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03207C 100 µg
MO-AB-11864R Monoclonal Cattle (Bos taurus) WB, ELISA MO11864R 100 µg
MO-AB-54733W Monoclonal Marmoset WB, ELISA MO54733W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset
CloneMO41518FYA
SpecificityThis antibody binds to Rhesus EFNA3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin.
Product OverviewMouse Anti-Rhesus EFNA3 Antibody is a mouse antibody against EFNA3. It can be used for EFNA3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEphrin-A3; EFNA3
UniProt IDH9FAB0
Protein RefseqThe length of the protein is 152 amino acids long.
The sequence is show below: VLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry