Mouse Anti-EFNA4 Antibody (CBMOAB-41519FYA)


Cat: CBMOAB-41519FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41519FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO41519FYA 100 µg
MO-AB-03208H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03208C 100 µg
MO-AB-11865R Monoclonal Cattle (Bos taurus) WB, ELISA MO11865R 100 µg
MO-AB-22717W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22717W 100 µg
MO-AB-25593H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25593C 100 µg
MO-AB-54734W Monoclonal Marmoset WB, ELISA MO54734W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO41519FYA
SpecificityThis antibody binds to Rhesus EFNA4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. Three transcript variants that encode distinct proteins have been identified.
Product OverviewMouse Anti-Rhesus EFNA4 Antibody is a mouse antibody against EFNA4. It can be used for EFNA4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEFNA4
UniProt IDF7ECH7
Protein RefseqThe length of the protein is 214 amino acids long.
The sequence is show below: MRLLPLLRTVLWATFLGSPLRGGSSVRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAFKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERSKPCLSPQGARALPRSPEGGGSAACTGGTHSDRQDGALMGEIRGSEVTLAGACPLITG.
For Research Use Only | Not For Clinical Use.
Online Inquiry