Mouse Anti-EGLN2 Antibody (CBMOAB-41545FYA)


Cat: CBMOAB-41545FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41545FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO41545FYA 100 µg
CBMOAB-74604FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74604FYA 100 µg
MO-AB-03218H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03218C 100 µg
MO-AB-11877R Monoclonal Cattle (Bos taurus) WB, ELISA MO11877R 100 µg
MO-AB-15366W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15366W 100 µg
MO-AB-54753W Monoclonal Marmoset WB, ELISA MO54753W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO41545FYA
SpecificityThis antibody binds to Rhesus EGLN2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene.
Product OverviewMouse Anti-Rhesus EGLN2 Antibody is a mouse antibody against EGLN2. It can be used for EGLN2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEGLN2
UniProt IDF6Z177
Protein RefseqThe length of the protein is 158 amino acids long.
The sequence is show below: MCLPSPSKPTSLHSCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVGVRVRVGLGSRLGLGRGRWASTPFSTLSPDSGILLFLFSAHSQGCNLLALPGKWHHLLSIWLCDGNSPLSGNGAVCPAPPGLVMNTFPLFLSLVASCPSPW.
For Research Use Only | Not For Clinical Use.
Online Inquiry