AibGenesis™ Mouse Anti-Eif-5A Antibody (CBMOAB-16109FYA)


Cat: CBMOAB-16109FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16109FYA Monoclonal Fruit fly (Drosophila melanogaster), Arabidopsis (Arabidopsis lyrata), Malaria parasite WB, ELISA MO16109FYA 100 µg
MO-AB-00442H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00442C 100 µg
MO-AB-12216H Monoclonal Malaria parasite WB, ELISA MO12216C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Arabidopsis (Arabidopsis lyrata), Malaria parasite
CloneMO16109FYA
SpecificityThis antibody binds to fruit fly Eif-5A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Eif-5A Antibody is a mouse antibody against Eif-5A. It can be used for Eif-5A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEukaryotic translation initiation factor 5A; eIF-5A; eIF-5A
UniProt IDQ9GU68
Protein RefseqThe length of the protein is 159 amino acids long.
The sequence is show below: MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDIFSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGELGEQLRLDFDSGKDLLCTVLKACGEECVIAIKTNTALDK.
For Research Use Only | Not For Clinical Use.
Online Inquiry