Mouse Anti-EIF3K Antibody (MO-AB-00420L)
Cat: MO-AB-00420L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-00420L | Monoclonal | Elephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Gorilla, Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Frog (Xenopus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO00420L | 100 µg | ||
CBMOAB-74712FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO74712FYA | 100 µg | ||
MO-AB-02544W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02544W | 100 µg | ||
MO-AB-08004W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08004W | 100 µg | ||
MO-AB-12777W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12777W | 100 µg | ||
MO-AB-30676W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30676W | 100 µg | ||
MO-AB-34713W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34713W | 100 µg | ||
MO-AB-38538W | Monoclonal | Gorilla | WB, ELISA | MO38538W | 100 µg | ||
MO-AB-41604W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41604W | 100 µg | ||
MO-AB-44547W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44547W | 100 µg | ||
MO-AB-54817W | Monoclonal | Marmoset | WB, ELISA | MO54817W | 100 µg | ||
MO-AB-11930R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11930R | 100 µg | ||
MO-AB-00439R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00439R | 100 µg | ||
MO-AB-25554R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25554R | 100 µg | ||
MO-AB-25612H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25612C | 100 µg | ||
MO-AB-33065H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33065C | 100 µg | ||
MO-AB-07985Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07985Y | 100 µg | ||
MO-AB-11303Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11303Y | 100 µg | ||
MO-AB-15151Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15151Y | 100 µg | ||
MO-DKB-01340W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Frog (Xenopus) | WB, IF | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Elephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Gorilla, Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Frog (Xenopus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO00420L |
Specificity | This antibody binds to Elephant EIF3K. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytosol; Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. |
Product Overview | This product is a mouse antibody against EIF3K. It can be used for EIF3K detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Eukaryotic Translation Initiation Factor 3 Subunit K; Eukaryotic Translation Initiation Factor 3, Subunit 12; Muscle-Specific Gene M9 Protein; EIF-3 P28; EIF3S12; PLAC-24; Eukaryotic Translation Initiation Factor 3, Subunit K; Eukaryotic Translation Initiation Factor 3 Subunit 12; Muscle Specific; EIF-3 P25 |
UniProt ID | G3U635 |
Protein Refseq | The length of the protein is 219 amino acids long. The sequence is show below: MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDSQLKVWMSKYGWSTDESGQIFICSQEESIKPKNIVEKIDFDRSLSFILGGSQ. |
See other products for " EIF3K "
CBMOAB-41613FYA | Mouse Anti-EIF3K Antibody (CBMOAB-41613FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry