Mouse Anti-EIF4A1 Antibody (CBMOAB-28170FYC)
Cat: CBMOAB-28170FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-28170FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO28170FC | 100 µg | ||
CBMOAB-41620FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO41620FYA | 100 µg | ||
MO-AB-03239H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03239C | 100 µg | ||
MO-AB-07987Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07987Y | 100 µg | ||
MO-AB-11934R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11934R | 100 µg | ||
MO-AB-23275W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23275W | 100 µg | ||
MO-AB-25557R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25557R | 100 µg | ||
MO-AB-25613H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25613C | 100 µg | ||
MO-AB-54822W | Monoclonal | Marmoset | WB, ELISA | MO54822W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
Clone | MO28170FC |
Specificity | This antibody binds to Arabidopsis EIF4A1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Nucleus; Cell Wall; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | EIF4A1 (Eukaryotic Translation Initiation Factor 4A1) is a Protein Coding gene. Among its related pathways are Translation Translation regulation by Alpha-1 adrenergic receptors and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and hydrolase activity. An important paralog of this gene is EIF4A2. |
Product Overview | Mouse Anti-Arabidopsis EIF4A1 Antibody is a mouse antibody against EIF4A1. It can be used for EIF4A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Eukaryotic Translation Initiation Factor 4A1; ATP-Dependent RNA Helicase EIF4A-1; EIF-4A-I; EIF4A-I; EIF4A; DDX2A; Eukaryotic Translation Initiation Factor 4A, Isoform 1 |
UniProt ID | F4JEL4 |
Protein Refseq | The length of the protein is 415 amino acids long. The sequence is show below: MAGSAPEGTQFDARQFDQKLNEVLEGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLRADNIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLCLRTWPICCEGRKEVGSVAVFALPY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry