Mouse Anti-ELANE Antibody (MO-AB-11955R)


Cat: MO-AB-11955R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-11955R Monoclonal Cattle (Bos taurus), Dog, Rhesus (Macaca mulatta) WB, ELISA MO11955R 100 µg
CBMOAB-41649FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO41649FYA 100 µg
MOFY-0722-FY149 Polyclonal Dog WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Dog, Rhesus (Macaca mulatta)
CloneMO11955R
SpecificityThis antibody binds to Cattle ELANE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionElastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode structurally similar proteins. The encoded preproprotein is proteolytically processed to generate the active protease. Following activation, this protease hydrolyzes proteins within specialized neutrophil lysosomes, called azurophil granules, as well as proteins of the extracellular matrix. The enzyme may play a role in degenerative and inflammatory diseases through proteolysis of collagen-IV and elastin. This protein also degrades the outer membrane protein A (OmpA) of E. coli as well as the virulence factors of such bacteria as Shigella, Salmonella and Yersinia. Mutations in this gene are associated with cyclic neutropenia and severe congenital neutropenia (SCN). This gene is present in a gene cluster on chromosome 19. (From NCBI)
Product OverviewMouse Anti-Cattle ELANE Antibody is a mouse antibody against ELANE. It can be used for ELANE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesELA2 protein; ELA2; ELANE
UniProt IDA6QPP7
Protein RefseqThe length of the protein is 267 amino acids long.
The sequence is show below: MTQSCRRFSPALAPILLALLLGGPALASEIVGGRAARPHAWPFIASLQRRGGHFCGATLIARNFVLSAAHCLNGLNFRSVRVVLGAHNLRRQERTRQMFRVRRVFENGFDPLSLQNDVVVLQLNRMATLNANVQVARLPAQDQGVGEGVRCVAMGWGRLGTNRPPPQILQQLNVTVVTGLCRPTNVCTLVPRRRAGICFGDSGGPLVCNGLVHGIDSFIRGGCGSGVFPDSFASVAKFANWINSIIRRYSDDDGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry