Mouse Anti-Elephant ANXA5 Antibody (MO-AB-00082L)
Cat: MO-AB-00082L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Elephant (Loxodonta africana) |
Clone | MO00082L |
Specificity | This antibody binds to Elephant ANXA5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted; Plasma membrane |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. [provided by RefSeq, Jul 2008] |
Product Overview | This product is a mouse antibody against ANXA5. It can be used for ANXA5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Annexin A5; Placental Anticoagulant Protein 4; Placental Anticoagulant Protein I; Vascular Anticoagulant-Alpha; Thromboplastin Inhibitor; Calphobindin I; Anchorin CII; Endonexin II; Lipocortin V; Annexin V; Annexin-5 |
UniProt ID | G3TF35 |
Protein Refseq | The length of the protein is 318 amino acids long. The sequence is show below: VLRGTVTDFPGFDERADAETLRKAMKGLGTDEETILTLLTSRSNAQRQEIIAAFKTLYGRDLLDDLKSELTGKFEKLIVALMKPSQLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAVKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDARIDEAQVELDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETCGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKSDTSGDYKKALLLLCGGEDD. |
See other products for " ANXA5 "
CBMOAB-35893FYA | Mouse Anti-Rhesus ANXA5 Antibody (CBMOAB-35893FYA) |
MO-AB-43682W | Mouse Anti-Horse ANXA5 Antibody (MO-AB-43682W) |
MO-AB-34387W | Mouse Anti-Ferret ANXA5 Antibody (MO-AB-34387W) |
MO-AB-22957H | Mouse Anti-Mallard ANXA5 Antibody (MO-AB-22957H) |
MO-AB-28967W | Mouse Anti-Dog ANXA5 Antibody (MO-AB-28967W) |
MO-AB-50950W | Mouse Anti-Marmoset ANXA5 Antibody (MO-AB-50950W) |
MO-AB-08042W | Mouse Anti-Cat ANXA5 Antibody (MO-AB-08042W) |
MO-AB-01449H | Mouse Anti-Frog anxa5 Antibody (MO-AB-01449H) |
MO-AB-07413R | Mouse Anti-Cattle ANXA5 Antibody (MO-AB-07413R) |
MO-AB-07204Y | Mouse Anti-Rabbit ANXA5 Antibody (MO-AB-07204Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry