Mouse Anti-Elephant EIF3G Antibody (MO-AB-00417L)
Cat: MO-AB-00417L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Elephant (Loxodonta africana) |
Clone | MO00417L |
Specificity | This antibody binds to Elephant EIF3G. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytosol; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. This subunit can bind 18S rRNA. |
Product Overview | This product is a mouse antibody against EIF3G. It can be used for EIF3G detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Eukaryotic Translation Initiation Factor 3 Subunit G; Eukaryotic Translation Initiation Factor 3, Subunit 4 Delta, 44kDa; Eukaryotic Translation Initiation Factor 3 RNA-Binding Subunit; EIF3S4; Eukaryotic Translation Initiation Factor 3 Subunit P42; Eukaryotic Translation Initiation Factor 3, Subunit G; Eukaryotic Translation Initiation Factor 3 Subunit 4; EIF-3 RNA-Binding Subunit |
UniProt ID | G3SY86 |
Protein Refseq | The length of the protein is 264 amino acids long. The sequence is show below: MPTGEFDSKPSWADQVEEEGEDDKCVTSELLKGIPLATGDTSPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKLKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQSKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGS. |
See other products for " EIF3G "
MO-AB-38535W | Mouse Anti-Gorilla EIF3G Antibody (MO-AB-38535W) |
MO-AB-34711W | Mouse Anti-Ferret EIF3G Antibody (MO-AB-34711W) |
CBMOAB-41610FYA | Mouse Anti-Rhesus EIF3G Antibody (CBMOAB-41610FYA) |
MO-AB-54811W | Mouse Anti-Marmoset EIF3G Antibody (MO-AB-54811W) |
MO-AB-11298Y | Mouse Anti-O. mykiss EIF3G Antibody (MO-AB-11298Y) |
MO-AB-08901W | Mouse Anti-Cat EIF3G Antibody (MO-AB-08901W) |
MO-AB-43113W | Mouse Anti-Hamsters EIF3G Antibody (MO-AB-43113W) |
CBMOAB-61856FYC | Mouse Anti-A. thaliana eIF3g Antibody (CBMOAB-61856FYC) |
MO-DKB-00876W | Rabbit Anti-EIF3G Antibody (MO-DKB-00876W) |
MO-AB-41602W | Mouse Anti-Guinea pig EIF3G Antibody (MO-AB-41602W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry