Mouse Anti-Elephant EIF6 Antibody (MO-AB-00424L)
Cat: MO-AB-00424L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Elephant (Loxodonta africana) |
Clone | MO00424L |
Specificity | This antibody binds to Elephant EIF6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytoskeleton; Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm. Behaves as a stimulatory translation initiation factor downstream insulin/growth factors. Is also involved in ribosome biogenesis. Associates with pre-60S subunits in the nucleus and is involved in its nuclear export. Cytoplasmic release of TIF6 from 60S subunits and nuclear relocalization is promoted by a RACK1 (RACK1)-dependent protein kinase C activity. In tissues responsive to insulin, controls fatty acid synthesis and glycolysis by exerting translational control of adipogenic transcription factors such as CEBPB, CEBPD and ATF4 that have G/C rich or uORF in their 5'UTR. Required for ROS-dependent megakaryocyte maturation and platelets formation, controls the expression of mitochondrial respiratory chain genes involved in reactive oxygen species (ROS) synthesis. Involved in miRNA-mediated gene silencing by the RNA-induced silencing complex (RISC). Required for both miRNA-mediated translational repression and miRNA-mediated cleavage of complementary mRNAs by RISC. Modulates cell cycle progression and global translation of pre-B cells, its activation seems to be rate-limiting in tumorigenesis and tumor growth. |
Product Overview | This product is a mouse antibody against EIF6. It can be used for EIF6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Eukaryotic Translation Initiation Factor 6; B4 Integrin Interactor; P27(BBP); ITGB4BP; EIF3a; EIF-6; CAB |
UniProt ID | G3T994 |
Protein Refseq | The length of the protein is 245 amino acids long. The sequence is show below: MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELADTIPVIHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDSVQIRRVEERFSALGNVTTCNDYVALVHPDLDRDTEEILADVLKVEVFRQTVADQVLVGSYSIFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSAIATSMRDSLVDRYL. |
See other products for " EIF6 "
MO-AB-34715W | Mouse Anti-Ferret EIF6 Antibody (MO-AB-34715W) |
MO-AB-54850W | Mouse Anti-Marmoset EIF6 Antibody (MO-AB-54850W) |
MO-AB-38541W | Mouse Anti-Gorilla EIF6 Antibody (MO-AB-38541W) |
MO-AB-30681W | Mouse Anti-Dog EIF6 Antibody (MO-AB-30681W) |
MO-AB-31412H | Mouse Anti-Soybean EIF6 Antibody (MO-AB-31412H) |
MO-AB-25627H | Mouse Anti-Rat Eif6 Antibody (MO-AB-25627H) |
MO-AB-30641H | Mouse Anti-Purple sea urchin EIF6 Antibody (MO-AB-30641H) |
MO-AB-33068H | Mouse Anti-Nile tilapia EIF6 Antibody (MO-AB-33068H) |
MO-AB-44557W | Mouse Anti-Horse EIF6 Antibody (MO-AB-44557W) |
MO-AB-13867Y | Mouse Anti-Sea-anemone EIF6 Antibody (MO-AB-13867Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry