AibGenesis™ Mouse Anti-ELK3 Antibody (CBMOAB-41672FYA)
Cat: CBMOAB-41672FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-41672FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus) | WB, ELISA | MO41672FYA | 100 µg | ||
| MO-AB-16768W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16768W | 100 µg | ||
| MO-AB-43119W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43119W | 100 µg | ||
| MO-AB-11965R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11965R | 100 µg | ||
| MO-AB-03258H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03258C | 100 µg | ||
| MO-DKB-00706W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) | WB, IF, IHC, IHC-Fr, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus) |
| Clone | MO41672FYA |
| Specificity | This antibody binds to Rhesus ELK3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. This protein is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present. Alternate splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus ELK3 Antibody is a mouse antibody against ELK3. It can be used for ELK3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ETS domain-containing protein Elk-3; ELK3 |
| UniProt ID | H9F0H4 |
| Protein Refseq | The length of the protein is 184 amino acids long. The sequence is show below: MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYYYDKNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREPHKHGLAALKSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIR. |
See other products for " elk3 "
| CBMOAB-74847FYA | AibGenesis™ Mouse Anti-elk3 Antibody (CBMOAB-74847FYA) |
| MO-AB-54878W | AibGenesis™ Mouse Anti-ELK3 Antibody (MO-AB-54878W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry