Mouse Anti-ELK3 Antibody (CBMOAB-41672FYA)


Cat: CBMOAB-41672FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41672FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus) WB, ELISA MO41672FYA 100 µg
MO-AB-16768W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16768W 100 µg
MO-AB-43119W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43119W 100 µg
MO-AB-11965R Monoclonal Cattle (Bos taurus) WB, ELISA MO11965R 100 µg
MO-AB-03258H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03258C 100 µg
MO-DKB-00706W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IF, IHC, IHC-Fr, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus)
CloneMO41672FYA
SpecificityThis antibody binds to Rhesus ELK3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. This protein is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present. Alternate splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus ELK3 Antibody is a mouse antibody against ELK3. It can be used for ELK3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesETS domain-containing protein Elk-3; ELK3
UniProt IDH9F0H4
Protein RefseqThe length of the protein is 184 amino acids long.
The sequence is show below: MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYYYDKNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREPHKHGLAALKSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIR.
See other products for " elk3 "
For Research Use Only | Not For Clinical Use.
Online Inquiry