AibGenesis™ Mouse Anti-ELMOD1 Antibody (CBMOAB-41683FYA)


Cat: CBMOAB-41683FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41683FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO41683FYA 100 µg
CBMOAB-74865FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74865FYA 100 µg
MO-AB-03264H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03264C 100 µg
MO-AB-11972R Monoclonal Cattle (Bos taurus) WB, ELISA MO11972R 100 µg
MO-AB-54883W Monoclonal Marmoset WB, ELISA MO54883W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO41683FYA
SpecificityThis antibody binds to Rhesus ELMOD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ELMOD1 Antibody is a mouse antibody against ELMOD1. It can be used for ELMOD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesELMOD1
UniProt IDF7GQ09
Protein RefseqThe length of the protein is 280 amino acids long.
The sequence is show below: MKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDINPQLGISLQACLLQIVGYRNLIADVEKLRREPYDSDNPQHEEMLLKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRHLCIYKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLISGALKTHFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM.
For Research Use Only | Not For Clinical Use.
Online Inquiry