Mouse Anti-ELN Antibody (CBMOAB-41685FYA)


Cat: CBMOAB-41685FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41685FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO41685FYA 100 µg
MO-AB-11978R Monoclonal Cattle (Bos taurus) WB, ELISA MO11978R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO41685FYA
SpecificityThis antibody binds to Rhesus ELN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is one of the two components of elastic fibers. Elastic fibers comprise part of the extracellular matrix and confer elasticity to organs and tissues including the heart, skin, lungs, ligaments, and blood vessels. The encoded protein is rich in hydrophobic amino acids such as glycine and proline, which form mobile hydrophobic regions bounded by crosslinks between lysine residues. Degradation products of the encoded protein, known as elastin-derived peptides or elastokines, bind the elastin receptor complex and other receptors and stimulate migration and proliferation of monocytes and skin fibroblasts. Elastokines can also contribute to cancer progression. Deletions and mutations in this gene are associated with supravalvular aortic stenosis (SVAS) and autosomal dominant cutis laxa.
Product OverviewMouse Anti-Rhesus ELN Antibody is a mouse antibody against ELN. It can be used for ELN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesELN
UniProt IDF6TF67
Protein RefseqThe length of the protein is 144 amino acids long.
The sequence is show below: GGKPLKPGPGGLAGTGLGAGLGAFPAGAFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGGIGGVGGVGGLGVSTGAVVPQPGAGVKPGKVPGVGLPGVYPGGVLPGTGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPG.
For Research Use Only | Not For Clinical Use.
Online Inquiry