Mouse Anti-Elob Antibody (CBMOAB-16224FYA)


Cat: CBMOAB-16224FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16224FYA Monoclonal Fruit fly (Drosophila melanogaster), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO16224FYA 100 µg
MO-AB-03269H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03269C 100 µg
MO-AB-25631H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25631C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO16224FYA
SpecificityThis antibody binds to fruit fly Elob.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13.
Product OverviewMouse Anti-D. melanogaster Elob Antibody is a mouse antibody against Elob. It can be used for Elob detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRE59129p; EloB; Elongin-B
UniProt IDQ8MYX5
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: MQPQQSVSQSPLREQQTAANTSSKSTAAANRDKINPLTLSLACPTQTKCMKLKSKLMVGPDEGGGRSICLRFSTSQRGEEAKAAVSTAIAKYAFFVVNSKEQLIYYGSDTKLNFGMGLIIFGFNFTLTP.
For Research Use Only | Not For Clinical Use.
Online Inquiry