AibGenesis™ Mouse Anti-elof1 Antibody (CBMOAB-74885FYA)
Cat: CBMOAB-74885FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-74885FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus) | WB, ELISA | MO74885FYA | 100 µg | ||
| MO-AB-14512W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO14512W | 100 µg | ||
| MO-AB-11983R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11983R | 100 µg | ||
| MO-AB-03270H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03270C | 100 µg | ||
| MO-AB-25633H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25633C | 100 µg | ||
| MO-AB-11312Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11312Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus) |
| Clone | MO74885FYA |
| Specificity | This antibody binds to Zebrafish elof1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Zebrafish elof1 Antibody is a mouse antibody against elof1. It can be used for elof1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Zgc:64163; elof1; zgc:64163; NP_956680. |
| UniProt ID | Q7T319 |
| Protein Refseq | The length of the protein is 83 amino acids long. The sequence is show below: MGRRKSKRKPPPKKKMTGNLDTQFTCPFCNHEKSCDVKMERSRNTGIISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry