Mouse Anti-ELOVL2 Antibody (CBMOAB-41688FYA)
Cat: CBMOAB-41688FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-41688FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Gorilla, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO41688FYA | 100 µg | ||
CBMOAB-61153FYC | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO61153FYC | 100 µg | ||
CBMOAB-74897FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO74897FYA | 100 µg | ||
MO-AB-00426L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00426L | 100 µg | ||
MO-AB-01739Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01739Y | 100 µg | ||
MO-AB-03273H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03273C | 100 µg | ||
MO-AB-08002Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08002Y | 100 µg | ||
MO-AB-09186W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09186W | 100 µg | ||
MO-AB-11985R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11985R | 100 µg | ||
MO-AB-15160Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15160Y | 100 µg | ||
MO-AB-16118W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16118W | 100 µg | ||
MO-AB-23178H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23178C | 100 µg | ||
MO-AB-25571R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25571R | 100 µg | ||
MO-AB-30684W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30684W | 100 µg | ||
MO-AB-34717W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34717W | 100 µg | ||
MO-AB-38543W | Monoclonal | Gorilla | WB, ELISA | MO38543W | 100 µg | ||
MO-AB-41608W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41608W | 100 µg | ||
MO-AB-44583W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44583W | 100 µg | ||
MO-AB-54885W | Monoclonal | Marmoset | WB, ELISA | MO54885W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Gorilla, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO41688FYA |
Specificity | This antibody binds to Rhesus ELOVL2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Endoplasmic reticulum; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | ELOVL2 (ELOVL Fatty Acid Elongase 2) is a Protein Coding gene. Diseases associated with ELOVL2 include Melanoma, Cutaneous Malignant 1. Among its related pathways are Fatty Acyl-CoA Biosynthesis and Ectoderm Differentiation. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring acyl groups other than amino-acyl groups and fatty acid elongase activity. An important paralog of this gene is ELOVL5. |
Product Overview | Mouse Anti-Rhesus ELOVL2 Antibody is a mouse antibody against ELOVL2. It can be used for ELOVL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Elongation of very long chain fatty acids protein; EC 2.3.1.199; Very-long-chain 3-oxoacyl-CoA synthase; ELOVL2 |
UniProt ID | I0FIY2 |
Protein Refseq | The length of the protein is 296 amino acids long. The sequence is show below: MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVIYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYIQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFSAANGVMNKKAQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry