Mouse Anti-ELP4 Antibody (MO-AB-10336W)


Cat: MO-AB-10336W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-10336W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset, Yeast WB, ELISA MO10336W 100 µg
CBMOAB-01178CR Monoclonal Yeast WB, ELISA MO01178CR 100 µg
MO-AB-54896W Monoclonal Marmoset WB, ELISA MO54896W 100 µg
MO-AB-11994R Monoclonal Cattle (Bos taurus) WB, ELISA MO11994R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset, Yeast
CloneMO10336W
SpecificityThis antibody binds to Chimpanzee ELP4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a component of the six subunit elongator complex, a histone acetyltransferase complex that associates directly with RNA polymerase II during transcriptional elongation. The human gene can partially complement sensitivity phenotypes of yeast ELP4 deletion mutants. This gene has also been associated with Rolandic epilepsy. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Chimpanzee ELP4 Antibody is a mouse antibody against ELP4. It can be used for ELP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesElongation protein 4 homolog; ELP4
UniProt IDK7B7G2
Protein RefseqThe length of the protein is 424 amino acids long.
The sequence is show below: MAAAATCGSVAASTGSAVATASKNNVTSFQRRGRRASGTNDSGPRLVSITGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASNWHGFFLPEKISSTLKVEPCSLTPGYTKLLQFIQNIIYEEGFDGSNPQKKQRNILRIGIQNLGSPLWGDDICCAENGGNSHSLTKFLYVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDIVVGLESFIGSERETNPLYKDYHGLIHIRQIPRLNNLICDESDVKDLAFKLKRKLFTIERLHLPPDLSDTVSRSSKMDLAESAKRLGPGCGMMAGGKKHLDF.
See other products for " ELP4 "
For Research Use Only | Not For Clinical Use.
Online Inquiry