Mouse Anti-emc1 Antibody (MO-AB-03277H)


Cat: MO-AB-03277H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03277H Monoclonal Frog (Xenopus laevis), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) WB, ELISA MO03277C 100 µg
CBMOAB-41706FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO41706FYA 100 µg
CBMOAB-74925FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74925FYA 100 µg
CBMOAB-01180CR Monoclonal Yeast WB, ELISA MO01180CR 100 µg
CBMOAB-03298HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO03298HB 100 µg
MO-AB-10605W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10605W 100 µg
MO-AB-54904W Monoclonal Marmoset WB, ELISA MO54904W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio)
CloneMO03277C
SpecificityThis antibody binds to Frog emc1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a single-pass type I transmembrane protein, which is a subunit of the endoplasmic reticulum membrane protein complex (EMC). Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewThis product is a mouse antibody against emc1. It can be used for emc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC98245 protein; MGC98245
UniProt IDQ5XK86
Protein RefseqThe length of the protein is 473 amino acids long.
The sequence is show below: MAAGLCWVSLLLASVALSRAVYEDQVGKFDWRQQYMGRIKFASLESGLGAKKLIAATDKNIVAALNSRTGDLLWRHVDKDTSEGTVDALMMIGQDAITVSGGRLLRSWETNIGALNWEAVLEPGSFQALSFAGSQDTARYVAVLKNSELSLHFLSNGHLKWSESIPESDSVQYQLLHSPYKGSVHVVGLVPQSHLTILTFSVEDGSISHQVRVLTPWLRTLHGTCGVIGEGVLVCGDAPMASVHIVSLLSGEETTRYSLQSLGIELAEELTQLDVITAPQNGIGESLSQFFLQIAPRRFVLMQHRDGVLTPLRDFSQVSLVNFATTGEKTVVAVMQCKTEGNQKSGPEPEDPTGQNCAEEPWYCPGHTYSINLYMADSGRRLLETTMSFTLDQSCVRPDSFYLQTFLRKDDSVGYRALVQTEDNQLLFLQQPGKSIWLREESLADVVTMEMVDLPLTGAQAELEGEFGKKAGK.
See other products for " EMC1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry