AibGenesis™ Mouse Anti-emc7 Antibody (CBMOAB-74934FYA)


Cat: CBMOAB-74934FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-74934FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO74934FYA 100 µg
MO-AB-10426W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10426W 100 µg
MO-AB-12004R Monoclonal Cattle (Bos taurus) WB, ELISA MO12004R 100 µg
MO-AB-25639H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25639C 100 µg
MO-AB-54911W Monoclonal Marmoset WB, ELISA MO54911W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO74934FYA
SpecificityThis antibody binds to Zebrafish emc7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish emc7 Antibody is a mouse antibody against emc7. It can be used for emc7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesER membrane protein complex subunit 7; emc7; si:ch211-150c22.
UniProt IDF1R0Q5
Protein RefseqThe length of the protein is 244 amino acids long.
The sequence is show below: MPHIKRLLDVYIALQALFALSWGFSDPEPGPVAASQSNGDRFKIEGRAIVPGVKTQDWISTARVLVEGEEYVGFLKTDGSFAVNDVPSGSYVVEIVSPSFRFEPVRVDITSKGKMRARLVNYIKTSEVIRQPYPLQIRAGGPHTYFMKRETWGWTDFLMNPMVMMMVLPLLIIVLLPKVVNTNDPEMRKEMEQSMNMLNPNPELPDVSEFMTKLFSKGSSKSGGGNKGSRSVATKRRSDRFPAP.
For Research Use Only | Not For Clinical Use.
Online Inquiry