Mouse Anti-Enho Antibody (MO-AB-25650H)


Cat: MO-AB-25650H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-25650H Monoclonal Rat (Rattus norvegicus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa) WB, ELISA MO25650C 100 µg
MO-AB-17393W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17393W 100 µg
MO-AB-54944W Monoclonal Marmoset WB, ELISA MO54944W 100 µg
MO-AB-12025R Monoclonal Cattle (Bos taurus) WB, ELISA MO12025R 100 µg
MO-AB-25591R Monoclonal Pig (Sus scrofa) WB, ELISA MO25591R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa)
CloneMO25650C
SpecificityThis antibody binds to Rat Enho.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against Enho. It can be used for Enho detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein LOC100912292; RGD1565232; LOC100912292
UniProt IDD3ZUG5
Protein RefseqThe length of the protein is 76 amino acids long.
The sequence is show below: MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP.
For Research Use Only | Not For Clinical Use.
Online Inquiry