Mouse Anti-Enho Antibody (MO-AB-25650H)
Cat: MO-AB-25650H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-25650H | Monoclonal | Rat (Rattus norvegicus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa) | WB, ELISA | MO25650C | 100 µg | ||
MO-AB-17393W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17393W | 100 µg | ||
MO-AB-54944W | Monoclonal | Marmoset | WB, ELISA | MO54944W | 100 µg | ||
MO-AB-12025R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12025R | 100 µg | ||
MO-AB-25591R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25591R | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa) |
Clone | MO25650C |
Specificity | This antibody binds to Rat Enho. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | This product is a mouse antibody against Enho. It can be used for Enho detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein LOC100912292; RGD1565232; LOC100912292 |
UniProt ID | D3ZUG5 |
Protein Refseq | The length of the protein is 76 amino acids long. The sequence is show below: MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry