AibGenesis™ Mouse Anti-ENOSF1 Antibody (CBMOAB-41786FYA)


Cat: CBMOAB-41786FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41786FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO41786FYA 100 µg
CBMOAB-75033FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75033FYA 100 µg
MO-AB-12032R Monoclonal Cattle (Bos taurus) WB, ELISA MO12032R 100 µg
MO-AB-26301W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26301W 100 µg
MO-AB-54953W Monoclonal Marmoset WB, ELISA MO54953W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO41786FYA
SpecificityThis antibody binds to Rhesus ENOSF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene can encode a mitochondrial enzyme that is thought to convert L-fuconate to 2-keto-3-deoxy-L-fuconate. This locus was originally identified as the source of antisense RNAs of the adjacent thymidylate synthase gene. Splice variants at this locus may contain an alternate 3' exon that is complementary to the 3'UTR and terminal intron of the thymidylate synthase (TS) RNA and may downregulate TS expression. (From NCBI)
Product OverviewMouse Anti-Rhesus ENOSF1 Antibody is a mouse antibody against ENOSF1. It can be used for ENOSF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial enolase superfamily member 1 isoform rTSbeta; ENOSF1
UniProt IDI0FLL5
Protein RefseqThe length of the protein is 443 amino acids long.
The sequence is show below: MVRGRISRLSVRDVRFPTSLGGHGSDAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGKGTEVVVCAVNALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPVWKLLVDMDPRTLVSCIDFRYITDVLTEEDALEILQKGQVGKKEREKQMLAQGYPAYTTSCAWLGYSDDTLKQLCAQALKDGWTRFKVKVGADLQDDVRRCQIIRDMIGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHAAISKALVPLGIGIATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVGLCELVQHLIIFDYISVSASLKNRMCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKKLLAAQEN.
For Research Use Only | Not For Clinical Use.
Online Inquiry