Mouse Anti-ENTPD2 Antibody (CBMOAB-41806FYA)


Cat: CBMOAB-41806FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41806FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO41806FYA 100 µg
CBMOAB-59830FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59830FYC 100 µg
MO-AB-12044R Monoclonal Cattle (Bos taurus) WB, ELISA MO12044R 100 µg
MO-AB-25653H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25653C 100 µg
MO-AB-54966W Monoclonal Marmoset WB, ELISA MO54966W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO41806FYA
SpecificityThis antibody binds to Rhesus ENTPD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is the type 2 enzyme of the ecto-nucleoside triphosphate diphosphohydrolase family (E-NTPDase). E-NTPDases are a family of ecto-nucleosidases that hydrolyze 5'-triphosphates. This ecto-ATPase is an integral membrane protein. Alternative splicing of this gene results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus ENTPD2 Antibody is a mouse antibody against ENTPD2. It can be used for ENTPD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesENTPD2
UniProt IDF7C527
Protein RefseqThe length of the protein is 460 amino acids long.
The sequence is show below: PSPQYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGAGQSLVGCLEQALRDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLTAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLRLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHSFHPCWPRGFSTHVLLGDVYQSPCTVAQRPQTFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFIAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQQAHLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALVLLLHQVHSAKLPSTI.
For Research Use Only | Not For Clinical Use.
Online Inquiry