Mouse Anti-EPHB3 Antibody (CBMOAB-41869FYA)


Cat: CBMOAB-41869FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41869FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO41869FYA 100 µg
CBMOAB-75163FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75163FYA 100 µg
MO-AB-01779Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01779Y 100 µg
MO-AB-03338H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03338C 100 µg
MO-AB-25690R Monoclonal Pig (Sus scrofa) WB, ELISA MO25690R 100 µg
MO-AB-55026W Monoclonal Marmoset WB, ELISA MO55026W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO41869FYA
SpecificityThis antibody binds to Rhesus EPHB3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionEphrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into two groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. This gene encodes a receptor for ephrin-B family members.
Product OverviewMouse Anti-Rhesus EPHB3 Antibody is a mouse antibody against EPHB3. It can be used for EPHB3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEphrin type-B receptor 3; EPHB3
UniProt IDH9FAC4
Protein RefseqThe length of the protein is 104 amino acids long.
The sequence is show below: LIRNAASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV.
For Research Use Only | Not For Clinical Use.
Online Inquiry