Mouse Anti-ERCC1 Antibody (MO-AB-26883W)


Cat: MO-AB-26883W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-26883W Monoclonal Chimpanzee (Pan troglodytes), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Hamsters (Cricetinae), Zebrafish (Danio rerio) WB, ELISA MO26883W 100 µg
CBMOAB-28485FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO28485FC 100 µg
CBMOAB-75264FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75264FYA 100 µg
MO-AB-15113W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15113W 100 µg
MO-AB-43132W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43132W 100 µg
MO-AB-12104R Monoclonal Cattle (Bos taurus) WB, ELISA MO12104R 100 µg
MO-AB-03356H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03356C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Hamsters (Cricetinae), Zebrafish (Danio rerio)
CloneMO26883W
SpecificityThis antibody binds to Chimpanzee ERCC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand.
Product OverviewMouse Anti-Chimpanzee ERCC1 Antibody is a mouse antibody against ERCC1. It can be used for ERCC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesExcision repair protein; ERCC1
UniProt IDQ6UIQ5
Protein RefseqThe length of the protein is 251 amino acids long.
The sequence is show below: QSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFL.
For Research Use Only | Not For Clinical Use.
Online Inquiry