Mouse Anti-ERCC1 Antibody (MO-AB-26883W)
Cat: MO-AB-26883W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-26883W | Monoclonal | Chimpanzee (Pan troglodytes), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Hamsters (Cricetinae), Zebrafish (Danio rerio) | WB, ELISA | MO26883W | 100 µg | ||
CBMOAB-28485FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO28485FC | 100 µg | ||
CBMOAB-75264FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO75264FYA | 100 µg | ||
MO-AB-15113W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15113W | 100 µg | ||
MO-AB-43132W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43132W | 100 µg | ||
MO-AB-12104R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12104R | 100 µg | ||
MO-AB-03356H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03356C | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chimpanzee (Pan troglodytes), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Hamsters (Cricetinae), Zebrafish (Danio rerio) |
Clone | MO26883W |
Specificity | This antibody binds to Chimpanzee ERCC1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand. |
Product Overview | Mouse Anti-Chimpanzee ERCC1 Antibody is a mouse antibody against ERCC1. It can be used for ERCC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Excision repair protein; ERCC1 |
UniProt ID | Q6UIQ5 |
Protein Refseq | The length of the protein is 251 amino acids long. The sequence is show below: QSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFL. |
See other products for " Ercc1 "
CBMOAB-16341FYA | Mouse Anti-Ercc1 Antibody (CBMOAB-16341FYA) |
CBMOAB-41937FYA | Mouse Anti-ERCC1 Antibody (CBMOAB-41937FYA) |
MO-AB-25703R | Mouse Anti-ERCC1 Antibody (MO-AB-25703R) |
CBMOAB-03377HCB | Mouse Anti-ERCC1 Antibody (CBMOAB-03377HCB) |
For Research Use Only | Not For Clinical Use.
Online Inquiry