AibGenesis™ Mouse Anti-Erm Antibody (CBMOAB-16350FYA)
Cat: CBMOAB-16350FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus) |
| Clone | MO16350FYA |
| Specificity | This antibody binds to fruit fly Erm. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Zinc-finger transcriptional repressor (PubMed:24550111, PubMed:24618901, PubMed:28245922). In larval brain, involved in the maintenance of cell fate of intermediate neural progenitors (INPs) that derive from type II neuroblasts (PubMed:20152183, PubMed:24618901, PubMed:27151950, PubMed:27510969, PubMed:28245922, PubMed:28899667). Restricts INP developmental potential and dedifferentiation by interacting with HDAC3 and the chromatin remodeling Brahma-associated protein (BAP) complex (PubMed:24618901, PubMed:24550111, PubMed:27151950, PubMed:28899667, PubMed:28245922). Restricts INP proliferation by regulating neuroblast specific factors such as prospero, pnt and grh, and by antagonizing the function of self-renewal factors, such as klu, dpn and E(spl)mgamma-HLH (PubMed:20152183, PubMed:24550111, PubMed:28899667). In the optic lobe, essential for coordinating the innervation/ targeting of the L3 and R8 axons to the M3 layer of the medulla (PubMed:29513217). Early in medulla development, functions in parallel to CadN and Sema1a pathways to promote targeting of the L3 growth cones to the proximal domain of the outer medulla possibly by controlling the expression of various cell surface genes such as dpr1 and dpr17 which function in L3 growth cone targeting (PubMed:29513217). Then once L3 growth cones segregate into the developing M3 layer, it activates the expression of netrins NetA and NetB which act locally to promote the attachment of R8 growth cones within the M3 layer (PubMed:29513217). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-D. melanogaster Erm Antibody is a mouse antibody against Erm. It can be used for Erm detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Earmuff, isoform C; erm |
| UniProt ID | M9PB02 |
| Protein Refseq | The length of the protein is 654 amino acids long. The sequence is show below: MVYFSPRGMQPCSPAGEIAMMPPSKSPVMESAASEQNPAQQSQQQDEQSAKRACPLKFSIAKIMEPDHRPSQVPPPQPAPVSFATNDDDEDEDPEIDADSERSCSPIEVISLDQSPSTVNYDSAFKKYVPGPCSGATSSVASPPSTAAVQQFVSSRHQELLSQYPLLYYAPNQLMCAAAAAQYAALTAQQQSLASAAHLSSFTASLNASLHHSQSLRRNLGHPLAAAAAVAAVAQSQAVPNLQHTLEKSPVAQRTAQSSGLQANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLHEIGGDLDDLDMPPTYDRRREYTRREPLASGYGQASGQLTPDSSSGSMSPPINVTTPPLSSGETSNPAWPRSAVSQYPPGGFHHQLGVAPPHDYPSGSAFLQLQPQQPHPQSQQHHQQQQRLSETFIAKVFXQRYYAESLNSSTGSTSTTSSTVTTTTTAISSMATSRSDLLID. |
For Research Use Only | Not For Clinical Use.
Online Inquiry