AibGenesis™ Mouse Anti-etfb Antibody (CBMOAB-75411FYA)


Cat: CBMOAB-75411FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-75411FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster) WB, ELISA MO75411FYA 100 µg
MO-AB-02560W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02560W 100 µg
MO-AB-12155R Monoclonal Cattle (Bos taurus) WB, ELISA MO12155R 100 µg
MO-AB-03384H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03384C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster)
CloneMO75411FYA
SpecificityThis antibody binds to Zebrafish etfb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria. Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish etfb Antibody is a mouse antibody against etfb. It can be used for etfb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesElectron-transfer-flavoprotein, beta polypeptide; etf
UniProt IDQ7ZV76
Protein RefseqThe length of the protein is 254 amino acids long.
The sequence is show below: MSARVLVGVKRVIDYAVKIRVKPDHTGVVTDGVKHSMNPFCEIAVEEAVKLKEKKLIKEVVAVSCGPQQVQETIRTALAMGADRGIHVEVSGKDYETLGPLQVSKILAALAKKEEASLIILGKQAIDDDCNQTGQMTAALLDWPQGTFASELAFEADKLKVVREIDGGLETIKIKLPAVVTADLRLNTPRYATLPNIMKAKKKKIAMVKPADLGVDVSSRLEVLKVDEPPTRQAGVKVETVEDLVGKLKEAGRV.
For Research Use Only | Not For Clinical Use.
Online Inquiry