AibGenesis™ Mouse Anti-Exd Antibody (CBMOAB-16452FYA)


Cat: CBMOAB-16452FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16452FYA Monoclonal Fruit fly (Drosophila melanogaster), Bee, Crustacean, D. melanogaster (Drosophila melanogaster), Locust, Sepsidae, Spider, Silkworm (Bombyx mori) WB, ELISA MO16452FYA 100 µg
MO-AB-69787W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO69787W 100 µg
MO-NAB-00777W Monoclonal Bee, Crustacean, D. melanogaster (Drosophila melanogaster), Locust, Sepsidae, Spider IF, IHC, IP, WB NW0699 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Bee, Crustacean, D. melanogaster (Drosophila melanogaster), Locust, Sepsidae, Spider, Silkworm (Bombyx mori)
CloneMO16452FYA
SpecificityThis antibody binds to fruit fly Exd.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscription factor which acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless (wg), teashirt (tsh) and decapentaplegic (dpp), thus affecting segmental identity. Delimits the eye field and prevent inappropriate eye development. Required for proper localization of chordotonal organs within the peripheral nervous system. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Exd Antibody is a mouse antibody against Exd. It can be used for Exd detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHomeobox protein extradenticle; Dpbx; exd
UniProt IDP40427
Protein RefseqThe length of the protein is 376 amino acids long.
The sequence is show below: MEDPNRMLAHTGGMMAPQGYGLSGQDDGQNAGSENEVRKQKDIGEILQQIMSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPPQDSMGYPMGSGGYDQQQPYDNSMGGYDPNLHQDLSP.
For Research Use Only | Not For Clinical Use.
Online Inquiry