AibGenesis™ Mouse Anti-EXPB9 Antibody (CBMOAB-22693FYB)


Cat: CBMOAB-22693FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22693FYB Monoclonal Rice (Oryza), Soybean (Glycine max) WB, ELISA MO22693FYB 100 µg
MO-AB-31449H Monoclonal Soybean (Glycine max) WB, ELISA MO31449C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Soybean (Glycine max)
CloneMO22693FYB
SpecificityThis antibody binds to Rice EXPB9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCell wall; Extracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice EXPB9 Antibody is a mouse antibody against EXPB9. It can be used for EXPB9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesExpansin-B9; Beta-expansin-9; OsEXPB9; OsaEXPb1.6; EXPB9; Os10g0548600 LOC_Os10g40090
UniProt IDQ7XCG7
Protein RefseqThe length of the protein is 269 amino acids long.
The sequence is show below: MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQFY.
For Research Use Only | Not For Clinical Use.
Online Inquiry