Mouse Anti-F13B Antibody (CBMOAB-42142FYA)
Cat: CBMOAB-42142FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-42142FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio) | WB, ELISA | MO42142FYA | 100 µg | ||
CBMOAB-75631FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO75631FYA | 100 µg | ||
MO-AB-12217R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12217R | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio) |
Clone | MO42142FYA |
Specificity | This antibody binds to Rhesus F13B. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes coagulation factor XIII B subunit. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as a plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon activation by the cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. |
Product Overview | Mouse Anti-Rhesus F13B Antibody is a mouse antibody against F13B. It can be used for F13B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | F13B |
UniProt ID | F6XAB8 |
Protein Refseq | The length of the protein is 661 amino acids long. The sequence is show below: MRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYIFKSYYFPMSIDQKLSFFCLAGYTTESGRQEERTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKQTYEEGDVIQFFCHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVRIECELNFVIHGSEEIRCENGKWTEPPKCIEGQERVACEEPPFVENGAANLHSKIYYNGDKVTYACKSGYLLRGSNEITCNRGTWTLAPECVENNENCKHPPVVMNGAVADGLLASYAAGSSVEYRCNEYYLLKGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGDLIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGDIISSVVDTYENGSSVEYRCFDHHFLQGSREAYCLEGTWTTPPLCLEPCTLSFTEMEKNNLLLKWDFDNRPHILHGEYVEFICRGDTYPAELYITGSILRMQCDRGQLKYPRCIPRQRTLSYQEPLRT. |
For Research Use Only | Not For Clinical Use.
Online Inquiry