Mouse Anti-F13B Antibody (CBMOAB-42142FYA)


Cat: CBMOAB-42142FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42142FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio) WB, ELISA MO42142FYA 100 µg
CBMOAB-75631FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75631FYA 100 µg
MO-AB-12217R Monoclonal Cattle (Bos taurus) WB, ELISA MO12217R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio)
CloneMO42142FYA
SpecificityThis antibody binds to Rhesus F13B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes coagulation factor XIII B subunit. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as a plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon activation by the cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. (From NCBI)
Product OverviewMouse Anti-Rhesus F13B Antibody is a mouse antibody against F13B. It can be used for F13B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesF13B
UniProt IDF6XAB8
Protein RefseqThe length of the protein is 661 amino acids long.
The sequence is show below: MRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYIFKSYYFPMSIDQKLSFFCLAGYTTESGRQEERTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKQTYEEGDVIQFFCHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVRIECELNFVIHGSEEIRCENGKWTEPPKCIEGQERVACEEPPFVENGAANLHSKIYYNGDKVTYACKSGYLLRGSNEITCNRGTWTLAPECVENNENCKHPPVVMNGAVADGLLASYAAGSSVEYRCNEYYLLKGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGDLIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGDIISSVVDTYENGSSVEYRCFDHHFLQGSREAYCLEGTWTTPPLCLEPCTLSFTEMEKNNLLLKWDFDNRPHILHGEYVEFICRGDTYPAELYITGSILRMQCDRGQLKYPRCIPRQRTLSYQEPLRT.
For Research Use Only | Not For Clinical Use.
Online Inquiry