AibGenesis™ Mouse Anti-FAM104B Antibody (CBMOAB-42181FYA)


Cat: CBMOAB-42181FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42181FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO42181FYA 100 µg
MO-AB-17674W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17674W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO42181FYA
SpecificityThis antibody binds to Rhesus FAM104B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM104B Antibody is a mouse antibody against FAM104B. It can be used for FAM104B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM104B
UniProt IDF7D3G1
Protein RefseqThe length of the protein is 116 amino acids long.
The sequence is show below: MGGCPVRKRRRNGSKEDNHHSAQPKRNKRNPIFQDSQDTESFSWSDNERSSSCINIPERASGPEGNLNQIVIEPNVNIPQFLHEGYVPCQGLYSHINQTLKEAHFNSLQQRGRAPT.
For Research Use Only | Not For Clinical Use.
Online Inquiry