AibGenesis™ Mouse Anti-FAM117A Antibody (CBMOAB-42208FYA)


Cat: CBMOAB-42208FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42208FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO42208FYA 100 µg
MO-AB-11987W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11987W 100 µg
MO-AB-12277R Monoclonal Cattle (Bos taurus) WB, ELISA MO12277R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO42208FYA
SpecificityThis antibody binds to Rhesus FAM117A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM117A Antibody is a mouse antibody against FAM117A. It can be used for FAM117A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM117A
UniProt IDF7DY33
Protein RefseqThe length of the protein is 453 amino acids long.
The sequence is show below: MAGAAAGGRGGGAWGPGRGGSGGLRRGCSPPAPAGSPRAGLQPLRATIPFQLQQPHQRRDGGGRAASVPCSVAPEKSVSRPQPLQVRRTFSLDTILSSYLLGQWPRDADGAFTCCTNDKATQTPLSWQELEGERASSCAHKRSASWGSTDHRKEISKLKQQLQRTKLSRSGKEKERGSPLPGDHAVRGALRASPPSFPSGSPVLRLSPCLHRSLEGLNQELEEVFVKEQGEEELLRILEIPDGHRAPAPPQSGSCDHPLLLLEPGNLASSPSMSLASPQPCGPASHEEHRGAAEELASTPNDKASSPGHPAFLEDGSPSPVLAFAASPRPNHSYVFKREPPEGCEKVRVFEEATSPGPDLAFLTSCPDKNKVHFNPTGSAFCPVSLMKPLFPGMGFIFRNCPSNPGSPLPPASPRPPPRKDPEASKASPLPFEPWQRTPPSEESVLFQSSLMV.
For Research Use Only | Not For Clinical Use.
Online Inquiry