AibGenesis™ Mouse Anti-FAM123B Antibody (CBMOAB-42225FYA)


Cat: CBMOAB-42225FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42225FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO42225FYA 100 µg
MO-AB-16933W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16933W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO42225FYA
SpecificityThis antibody binds to Rhesus FAM123B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM123B Antibody is a mouse antibody against FAM123B. It can be used for FAM123B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein FAM123B; FAM123B
UniProt IDH9FF43
Protein RefseqThe length of the protein is 171 amino acids long.
The sequence is show below: RDSPLSLYTEPPGAYDWPAWAPCPIPVGPSPAWVSPNQLDRPSSQSPYEQATCCIPPMTTSMSLSVPESRAPGESRPQLARPSHLHLPMGPCYNLQPQASQSVRARPRDVLLPVDEPSCSSSSGGFSPSPLPQAKPVGITHGIPQLPRVQPEHPQPQPTHYGPSSLDLSKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry