AibGenesis™ Mouse Anti-FAM183A Antibody (MO-AB-12305R)


Cat: MO-AB-12305R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-12305R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO12305R 100 µg
MO-AB-25745H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25745C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO12305R
SpecificityThis antibody binds to Cattle FAM183A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle FAM183A Antibody is a mouse antibody against FAM183A. It can be used for FAM183A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein FAM183A; FAM183A
UniProt IDA8QW39
Protein RefseqThe length of the protein is 135 amino acids long.
The sequence is show below: MAGHQKEKAIADEVHQNQILRELYLKELRTQKLYTQYHVNPLRKVHTIARKPMSWHDNLEEPADARFLNLIHHAAQGPRKKYPETQTEGQEIGWDSEPLVNPQRDDRRLNHFRVYKDITLYKAKMWSLGEDDRHK.
For Research Use Only | Not For Clinical Use.
Online Inquiry